Description
IGF-1 LR3 Peptide Vial Portugal
This product is intended for research purposes only. To be used by trained professionals only.
IGF-1 LR3 peptide vial in research provides a solution to problems posed by the failure of the growth hormone. IGF-1 LR3, additionally called LR3-IGF-1, is an extended and customized variation of naturally developing IGF-1. In contrast to IGF-1, IGF-1 LR3 insulin-like growth factor consists of 13 different amino acids and has the amino acid arginine replaced ready 3.
This peptide-like growth factor 1 has the same structural configuration and insulin size. IGF-1 LR3 peptide vial belongs to the group of peptides known as growth factors. The IGF-1 LR3 peptide is essential for the growth hormones to develop in the muscles. The analogue is produced to facilitate the production of recombinant compounds.
These added amino acids boost the effectiveness of IGF-1 LR 3 to 3 times that of IGF binding proteins because it has around 1% affinity for IGF-binding healthy proteins, which act to obstruct the growth-promoting results of IGF1. As a result, the customized IGF-1 LR3 protein-peptide growth hormone has enhanced metabolic security and stays active in the body for longer than IGF-1 [1].
The lowered healthy protein binding and longer half-life suggest that the growth hormone peptide promotes muscle tissue and bone development and repair and smooth muscle survival [1]. IGF-1 LR3 peptide vial has been revealed to boost mass muscle development and raise muscular tissue mass by approximately 50 percent.
In addition, IGF-1 LR3 human growth hormone likewise regulates precisely how the body uses sugar by means of insulin signalling and can boost weight loss.
References:
[1] https://www.ncbi.nlm.nih.gov/ pmc/articles/PMC3792098/
Physical Appearance: White lyophilised solid
Purity: >98%
Molecular Weight: 9.1k
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Storage: Lyophilized peptides to be stored below -18°C
Research use only. Not for human or animal consumption!
DISCLAIMER: We do not supply peptides to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. Our team of dedicated professionals are committed to providing an extensive range of products used ONLY in the process of laboratory research by responsible trained and professional individuals. All products listed on this website (https://portugal.direct-peptides.com) and provided through Direct Peptides are intended for laboratory research purposes only. The products listed on this website are NOT for human or animal consumption or ingestion of any kind.
BUY IGF-1 LR3 Peptide Vial ONLINE today From Portugal Direct Peptides